Invitrogen™ Human KCNG4 (aa 163-218) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30202440	100 μL	100µL

Product Code. 30202440 Supplier Invitrogen™ Supplier No. RP110051

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144907 (PA5-144907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues.

Specifications

• Accession Number: Q8TDN1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 93107
• Name: Human KCNG4 (aa 163-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921535I01Rik; AW049024; KCNG3; Kcng4; KV6.3; KV6.4; potassium channel, voltage gated modifier subfamily G, member 4; potassium voltage-gated channel modifier subfamily G member 4; potassium voltage-gated channel subfamily G member 4; potassium voltage-gated channel, subfamily G, member 4; voltage-gated potassium channel Kv6.3; voltage-gated potassium channel subunit Kv6.3; voltage-gated potassium channel subunit Kv6.4
• Common Name: KCNG4
• Gene Symbol: KCNG4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining