Invitrogen™ Human KCNG1 (aa 469-513) Control Fragment Recombinant Protein

Product Code. 30182141

Brand: Invitrogen™ RP98323

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59033 (PA5-59033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues.

Specifications

• Accession Number: Q9UIX4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3755
• Name: Human KCNG1 (aa 469-513) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW536275; K13; KCNG; KCNG1; kH2; KV6.1; orthologue of H. sapiens potassium voltage-gated channel, subfamily G, member 1 (KCNG1); OTTMUSG00000016048; potassium channel KH2; potassium channel Kv6.1; potassium channel, voltage gated modifier subfamily G, member 1; potassium channel, voltage-gated modifier subfamily G, member 1; potassium voltage-gated channel modifier subfamily G member 1; potassium voltage-gated channel subfamily G member 1; potassium voltage-gated channel, subfamily G, member 1; voltage-gated potassium channel subunit Kv6.1
• Common Name: KCNG1
• Gene Symbol: KCNG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining