Invitrogen™ Human KCNE3 (aa 1-56) Control Fragment Recombinant Protein

Product Code. 30206464

Brand: Invitrogen™ RP90617

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53242 (PA5-53242. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion.

Specifications

• Accession Number: Q9Y6H6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10008
• Name: Human KCNE3 (aa 1-56) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210017H05Rik; cardiac voltage-gated potassium channel accessory subunit; HOKPP; HYPP; KCNE3; Minimum potassium ion channel-related peptide 2; minK-related peptide 2; MiRP2; potassium channel subunit beta MiRP2; potassium channel, voltage gated subfamily E regulatory beta subunit 3; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 3; potassium voltage-gated channel subfamily E member 3; potassium voltage-gated channel subfamily E regulatory subunit 3; potassium voltage-gated channel, Isk-related family, member 3; potassium voltage-gated channel, Isk-related subfamily, gene 3; potassium voltage-gated channel, Isk-related subfamily, member 3; voltage-gated K+ channel subunit MIRP2
• Common Name: KCNE3
• Gene Symbol: Kcne3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining