Invitrogen™ Human KCNE2 (aa 1-44) Control Fragment Recombinant Protein

Product Code. 30212126

Brand: Invitrogen™ RP102558

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56233 (PA5-56233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.

Specifications

• Accession Number: Q9Y6J6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9992
• Name: Human KCNE2 (aa 1-44) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2200002I16Rik; ATFB4; AW048273; cardiac voltage-gated potassium channel accessory subunit 2; CDW210B; CRF2-4; CRFB4; D21S58; D21S66; IL-10R2; Kcne2; LQT5; LQT6; minimum potassium ion channel related peptide 1; minimum potassium ion channel-related peptide 1; MinK-related peptide 1; minK-related peptide-1; MIRP1; Potassium channel subunit beta MiRP1; potassium channel subunit, MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2; potassium voltage-gated channel subfamily E member 2; potassium voltage-gated channel subfamily E regulatory subunit 2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel, Isk-related subfamily, gene 2; voltage-gated K+ channel subunit MIRP1
• Common Name: KCNE2
• Gene Symbol: KCNE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining