Invitrogen™ Human KChIP3 (aa 38-88) Control Fragment Recombinant Protein

Product Code. 30201068

Brand: Invitrogen™ RP107716

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels are key components of the potassium currents in the heart and central nervous system. In the heart, Kv4 channels are involved in the repolarization phase of the action potential. In the brain however, these channels prevent reverse-propagation of action potentials. Found associated with Kv4 channels are a group of calcium-binding proteins termed KChIPs (Kv channel interacting proteins). KChIPs are small molecular weight proteins that bind to the cytoplasmic amino termini of Kv4 alpha-subunits and help to modulate its function. There are currently three known KChIPs; KChIP1 expressed in the brain; KChIP2 expressed in the brain, heart, and lung, and has three isoforms, a, b, and c; and KChIP3, also known as calsenilin and DREAM (downstream regulatory elements (DRE)-antagonist modulator) which is expressed in the brain and testis. KChIP3 has activities beyond the modulation of Kv4 currents. It has been shown that KChIP3 binds to the regulatory DRE and represses transcription from the early-response gene c-fos. Thus, KCHiP3 is the first known calcium-binding protein to function as a DNA-binding transcriptional regulator. KChIP3 is also found associated with the presenilins and is implicated in the mediation of beta-amyloid formation.

Specifications

• Accession Number: Q9Y2W7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 30818
• Name: Human KChIP3 (aa 38-88) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933407H12Rik; AI413860; A-type potassium channel modulating protein 3; A-type potassium channel modulatory protein 3; Calsenilin; calsenilin presenilin-binding protein EF hand transcription factor; calsenilin, presenilin binding protein, EF hand transcription factor; calsenilin, presenilin-binding protein, EF hand transcription fa; calsenilin, presenilin-binding protein, EF hand transcription factor; CSEN; downstream regulatory element-antagonist modulator; DREAM; DRE-antagonist modulator; KChIP3; KCNIP3; Kv channel interacting protein 3; Kv channel interacting protein 3, calsenilin; kv channel-interacting protein 3; potassium channel interacting protein 3; potassium voltage-gated channel interacting protein 3; R74849; rKChIP3
• Common Name: KChIP3
• Gene Symbol: Kcnip3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining