Invitrogen™ Human KATNAL2 (aa 178-261) Control Fragment Recombinant Protein

Product Code. 30182727

Brand: Invitrogen™ RP98264

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59830 (PA5-59830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8IYT4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83473
• Name: Human KATNAL2 (aa 178-261) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: katanin catalytic subunit A like 2; katanin catalytic subunit A1 like 2; katanin p60 ATPase-containing subunit A-like 2; katanin p60 subunit A like 2; Katanin p60 subunit A-like 2; KATNAL2; p60 katanin-like 2
• Common Name: KATNAL2
• Gene Symbol: KATNAL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining