missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KANK3 (aa 396-450) Control Fragment Recombinant Protein

Product Code. 30182424
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182424

Brand: Invitrogen™ RP99982

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62333 (PA5-62333. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrins are membrane adaptor molecules that play important roles in the control of cytoskeleton formation by regulating actin polymerization. Like other members of the KANK family, KANK3 (KN motif and ankyrin repeat domain-containing protein 3), is thought to play a role in the formation of actin stress fibers. In zebrafish, the homolog of KANK3 interacts with the adaptor protein Numb, a protein implicated in multiple basic cellular processes, and is essential for epidermal integrity and neurulation, suggesting that KANK3 may play a similar role in higher organisms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6NY19
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 256949
Name Human KANK3 (aa 396-450) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610013D04Rik; Ankrd47; ankyrin repeat domain 47; ankyrin repeat domain-containing protein 47; D17Ertd288e; Kank3; kidney ankyrin repeat-containing protein 3; KN motif and ankyrin repeat domain-containing protein 3; KN motif and ankyrin repeat domains 3; NG28; putative KN motif and ankyrin repeat domains 3
Common Name KANK3
Gene Symbol KANK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.