missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207534

Invitrogen™ Human KANK1 (aa 314-456) Control Fragment Recombinant Protein

Product Code. 30207534
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207534

Brand: Invitrogen™ RP101071

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52159 (PA5-52159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrins are membrane adaptor molecules that play important roles in the control of cytoskeleton formation by regulating actin polymerization. KANK1 (KN motif and ankyrin repeat domain-containing protein 1), also known as ANKRD15, is a 1,352 amino acid protein that contains at least 12 exons and 5 ANK repeats. It binds to beta-catenin and regulates its subcellular distribution. KANK1 is ubiquitously expressed and localizes to cytoplasm. It may function as a tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14678
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23189
Name Human KANK1 (aa 314-456) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930031B09Rik; ANKRD15; ankyrin repeat domain 15; ankyrin repeat domain-containing protein 15; AU015049; AW121052; CPSQ2; D330024H06Rik; KANK; Kank1; KIAA0172; Kidney ankyrin repeat-containing protein; KN motif and ankyrin repeat domain-containing protein 1; KN motif and ankyrin repeat domains 1; mKIAA0172
Common Name KANK1
Gene Symbol Kank1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence INVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.