Invitrogen™ Human JWA (aa 129-188) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30208563	100 μL	100µL

Product Code. 30208563 Supplier Invitrogen™ Supplier No. RP91079

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53319 (PA5-53319. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JWA protein expression is affected by vitamin A and may be associated with the cytoskeleton. A protein similar to JWA in rats may play a role in the regulation of cell differentiation by inhibiting the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.

Specifications

• Accession Number: O75915
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10550
• Name: Human JWA (aa 129-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5930404D22Rik; addicsin; addiscin; ADP ribosylation factor like GTPase 6 interacting protein 5; ADP-ribosylation factor GTPase 6 interacting protein 5; ADP-ribosylation factor like GTPase 6 interacting protein 5; ADP-ribosylation factor-like 6 interacting protein 5; ADP-ribosylation factor-like protein 6-interacting protein 5; ADP-ribosylation-like factor 6 interacting protein 5; Aip5; Aip-5; ARL-6-interacting protein 5; Arl6ip5; AV001879; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; dermal papilla derived protein 11; dermal papilla-derived protein 11; DERP11; glutamate transporter EAAC1 interacting protein; glutamate transporter EAAC1-interacting protein; glutamate transporter EEAC1-associated protein; GTRAP3-18; hp22; HSPC127; JM5; jmx; Jwa; PRA1 domain family 3; PRA1 family protein 3; Pra2; Praf3; Prenylated Rab acceptor protein 2; protein JWa; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; Yip6b
• Common Name: JWA
• Gene Symbol: Arl6ip5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining