Invitrogen™ Human JunB (aa 28-146) Control Fragment Recombinant Protein

Product Code. 30194212

Brand: Invitrogen™ RP100749

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JunB, a member of the Jun cellular oncogene family, is a basic region, leucine zipper transcription factor. It is involved in regulating gene activity following the primary growth factor response. JunB binds to the DNA sequence 5'-TGA[CG]TCA-3'. Cellular oncogenes play critical roles in cellular communication pathways that regulate growth, development, and differentiation.

Specifications

• Accession Number: P17275
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3726
• Name: Human JunB (aa 28-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: activator protein 1; AP-1; Jun B; jun B proto-oncogene; Junb; Jun-b; Jun-B oncogene; JunB proto-oncogene, AP-1 transcription factor subunit; myD21; Oncogene Jun-B; Transcription factor jun-B
• Common Name: JunB
• Gene Symbol: Junb
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining