Invitrogen™ Human Jouberin (aa 877-981) Control Fragment Recombinant Protein

Product Code. 30195907

Brand: Invitrogen™ RP94850

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65106 (PA5-65106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is apparently required for both cerebellar and cortical development in humans. This gene mutations cause specific forms of Joubert syndrome-related disorders. Joubert syndrome (JS) is a recessively inherited developmental brain disorder with several identified causative chromosomal loci. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

• Accession Number: Q8N157
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54806
• Name: Human Jouberin (aa 877-981) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700015F03Rik; Abelson helper integration site 1; abelson helper integration site 1 protein; abelson helper integration site 1 protein homolog; Ahi1; AHI-1; contatins SH3 and WD40 domains; D10Bwg0629e; dJ71N10.1; JBTS3; jouberin; ORF1; RP1-32B1.2
• Common Name: Jouberin
• Gene Symbol: AHI1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining