missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human JMJD6 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30194717
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194717

Brand: Invitrogen™ RP109878

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6NYC1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23210
Name Human JMJD6 (aa 1-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730436I23Rik; apoptotic cell clearance receptor PtdSerR; arginine demethylase and lysine hydroxylase; bifunctional arginine demethylase and lysyl-hydroxylase JMJD6; D11Ertd195e; Histone arginine demethylase JMJD6; jmjC domain-containing protein 6; Jmjd6; jumonji domain containing 6; jumonji domain-containing protein 6; KIAA0585; Lysyl-hydroxylase JMJD6; mKIAA0585; Peptide-lysine 5-dioxygenase JMJD6; phosphatidylserine receptor; Protein PTDSR; PSR; PtdSerR; Ptdsr; PTDSR1
Common Name JMJD6
Gene Symbol JMJD6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.