Invitrogen™ Human JMJD6 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30194717

Brand: Invitrogen™ RP109878

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q6NYC1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23210
• Name: Human JMJD6 (aa 1-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730436I23Rik; apoptotic cell clearance receptor PtdSerR; arginine demethylase and lysine hydroxylase; bifunctional arginine demethylase and lysyl-hydroxylase JMJD6; D11Ertd195e; Histone arginine demethylase JMJD6; jmjC domain-containing protein 6; Jmjd6; jumonji domain containing 6; jumonji domain-containing protein 6; KIAA0585; Lysyl-hydroxylase JMJD6; mKIAA0585; Peptide-lysine 5-dioxygenase JMJD6; phosphatidylserine receptor; Protein PTDSR; PSR; PtdSerR; Ptdsr; PTDSR1
• Common Name: JMJD6
• Gene Symbol: JMJD6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining