Invitrogen™ Human JMJD4 (aa 243-347) Control Fragment Recombinant Protein

Product Code. 30198263

Brand: Invitrogen™ RP89683

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82962 (PA5-82962. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Covalent modification of histones plays critical role in regulating chromatin structure and transcription. While most covalent histone modifications are reversible, only recently has it been established that methyl groups are subject to enzymatic removal from histones. A family of novel JmjC domain-containing histone demethylation (JHDM) enzymes have been identified that perform this specific function. Histone demethylation by JHDM proteins requires cofactors Fe(II) and alpha-ketoglutarate. Family members include JHDM1 (demethylating histone 3 at lysine 36), and JHDM2A as well as JMJD2CH3K9 (both of which demethylate histone 3 at lysine 9). Contributions of histone demethylase activity to tumor development, decreases in cell proliferation, and hormone-dependent transcriptional activation have been observed.

Specifications

• Accession Number: Q9H9V9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65094
• Name: Human JMJD4 (aa 243-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-oxoglutarate- and Fe(II)-dependent oxygenase; 2-oxoglutarate and iron-dependent oxygenase JMJD4; 6430559I23; C4 lysyl hydroxylase; jmjC domain-containing protein 4; JMJD4; jumonji domain containing 4; jumonji domain-containing protein 4; Lysyl-hydroxylase JMJD4; RGD1307186
• Common Name: JMJD4
• Gene Symbol: Jmjd4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPALCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRFLQQEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining