Invitrogen™ Human JMJD2D (aa 474-522) Control Fragment Recombinant Protein

Product Code. 30210059

Brand: Invitrogen™ RP103926

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JMJD2D belongs to JMJD2 family that is consist of four cancer-associated genes.

Specifications

• Accession Number: Q6B0I6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55693
• Name: Human JMJD2D (aa 474-522) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ10251; JHDM3D; JmjC domain-containing histone demethylation protein 3 D; JMJD2D; jumonji domain containing 2 D; jumonji domain-containing protein 2 D; KDM4D; lysine (K)-specific demethylase 4 D; lysine demethylase 4 D; lysine-specific demethylase 4 D
• Common Name: JMJD2D
• Gene Symbol: KDM4D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQHPVKASGCSWAPV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining