missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197949

Invitrogen™ Human JMJD2C (aa 996-1054) Control Fragment Recombinant Protein

Product Code. 30197949
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197949

Brand: Invitrogen™ RP107688

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67044 (PA5-67044. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Jumonji domain-containing protein 2C (JMJD2C)/ Lysine-specific demethylase 4C (KDM4C) is a histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3; thereby, playing a central role in histone code. KDM4C does not demethylate histone H3 'Lys-4', H3 'Lys-27', or H4 'Lys-20'. It demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residues. There is no activity on mono- or dimethylated residues. Demethylation of Lys residues generates formaldehyde and succinate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H3R0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23081
Name Human JMJD2C (aa 996-1054) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410141F18Rik; AA517467; bA146B14.1; GASC1; GASC-1 protein; gene amplified in squamous cell carcinoma 1; gene amplified in squamous cell carcinoma 1 protein; JHDM3C; JmjC domain-containing histone demethylation protein 3 C; JMJD2C; jumonji domain containing 2 C; jumonji domain-containing protein 2 C; Kdm4c; KIAA0780; lysine (K)-specific demethylase 4 C; lysine demethylase 4 C; lysine-specific demethylase 4 C; RP11-169L18.1; TDRD14C; tudor domain containing 14 C
Common Name JMJD2C
Gene Symbol KDM4C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.