Invitrogen™ Human JMJD1B (aa 740-814) Control Fragment Recombinant Protein

Product Code. 30212643

Brand: Invitrogen™ RP105061

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.

Specifications

• Accession Number: Q7LBC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51780
• Name: Human JMJD1B (aa 740-814) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830462I21Rik; 5 qNCA; C5orf7; JHDM2B; JmjC domain-containing histone demethylation protein 2 B; JMJD1B; jumonji domain containing 1 B; jumonji domain-containing protein 1 B; KDM3B; KDM3B lysine (K)-specific demethylase 3 B; KIAA1082; lysine (K)-specific demethylase 3 B; lysine demethylase 3 B; lysine-specific demethylase 3 B; mKIAA1082; NET22; Nuclear protein 5 qNCA
• Common Name: JMJD1B
• Gene Symbol: KDM3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining