Invitrogen™ Human JLP (aa 815-939) Control Fragment Recombinant Protein

Product Code. 30210460

Brand: Invitrogen™ RP89951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59182 (PA5-59182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.

Specifications

• Accession Number: O60271
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9043
• Name: Human JLP (aa 815-939) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110018C07Rik; 4733401I23Rik; 4831406C20Rik; AW552012; Cancer/testis antigen 89; c-Jun NH2-terminal kinase-associated leucine zipper protein; C-Jun-amino-terminal kinase-interacting protein 4; CT89; HLC4; HLC6; HLC-6; HSS; Human lung cancer oncogene 6 protein; Jip4; JIP-4; JLP; JNK interacting protein; JNK/SAPK-associated protein; JNK/SAPK-associated protein 2; JNK-associated leucine-zipper protein; JNK-interacting leucine zipper; JNK-interacting protein 4; Jsap2; JSAP2a; Kiaa0516; lung cancer oncogene 4; Mapk8ip4; Max-binding protein; mitogen-activated protein kinase 8-interacting protein 4; PHET; PIG6; proliferation-inducing gene 6; Proliferation-inducing protein 6; Protein highly expressed in testis; SPAG9; sperm associated antigen 9; sperm associated antigen 9 variant 5; sperm surface protein; Sperm-associated antigen 9; Sperm-specific protein; Sunday driver 1; syd1
• Common Name: JLP
• Gene Symbol: SPAG9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining