missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human JLP (aa 694-771) Control Fragment Recombinant Protein

Product Code. 30203830
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203830

Brand: Invitrogen™ RP107069

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111525 (PA5-111525. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60271
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9043
Name Human JLP (aa 694-771) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110018C07Rik; 4733401I23Rik; 4831406C20Rik; AW552012; Cancer/testis antigen 89; c-Jun NH2-terminal kinase-associated leucine zipper protein; C-Jun-amino-terminal kinase-interacting protein 4; CT89; HLC4; HLC6; HLC-6; HSS; Human lung cancer oncogene 6 protein; Jip4; JIP-4; JLP; JNK interacting protein; JNK/SAPK-associated protein; JNK/SAPK-associated protein 2; JNK-associated leucine-zipper protein; JNK-interacting leucine zipper; JNK-interacting protein 4; Jsap2; JSAP2a; Kiaa0516; lung cancer oncogene 4; Mapk8ip4; Max-binding protein; mitogen-activated protein kinase 8-interacting protein 4; PHET; PIG6; proliferation-inducing gene 6; Proliferation-inducing protein 6; Protein highly expressed in testis; SPAG9; sperm associated antigen 9; sperm associated antigen 9 variant 5; sperm surface protein; Sperm-associated antigen 9; Sperm-specific protein; Sunday driver 1; syd1
Common Name JLP
Gene Symbol SPAG9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.