Invitrogen™ Human JIP3 (aa 711-800) Control Fragment Recombinant Protein

Product Code. 30204375

Brand: Invitrogen™ RP104067

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64408 (PA5-64408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members, JNK2 and JNK3, have been identified. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Specifications

• Accession Number: Q9UPT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23162
• Name: Human JIP3 (aa 711-800) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BB120594; c-Jun NH2-terminal kinase (JNK)/stress-activated protein kinase-associated protein 1; C-jun-amino-terminal kinase interacting protein 3; C-Jun-amino-terminal kinase-interacting protein 3; D17Wsu15e; homolog of Drosophila Sunday driver 2; JIP3; JIP-3; JNK MAP kinase scaffold protein 3; JNK/SAPK-associated protein 1; JNK/SAPK-associated protein 1 c; JNK/SAPK-associated protein-1; JNK/stress-activated protein kinase-associated protein 1; JNK-interacting protein 3; JSAP1; JSAP1a; JSAP1b; JSAP1c; JSAP1d; JUN/SAPK-associated protein 1; KIAA1066; MAPK8IP3; mitogen activated protein kinase 8 interacting protein 3; mitogen-activated protein kinase 8 interacting protein 3; mitogen-activated protein kinase 8-interacting protein 3; mKIAA1066; Sunday driver 2; syd; SYD2
• Common Name: JIP3
• Gene Symbol: MAPK8IP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining