missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210759

Invitrogen™ Human JIP2 (aa 8-83) Control Fragment Recombinant Protein

Product Code. 30210759
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210759

Brand: Invitrogen™ RP94964

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57057 (PA5-57057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is closely related to MAPK8IP1/IB1/JIP-1, a scaffold protein that is involved in the c-Jun amino-terminal kinase signaling pathway. This protein is expressed in brain and pancreatic cells. It has been shown to interact with, and regulate the activity of MAPK8/JNK1, and MAP2K7/MKK7 kinases. This protein thus is thought to function as a regulator of signal transduction by protein kinase cascade in brain and pancreatic beta-cells. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13387
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23542
Name Human JIP2 (aa 8-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3230402N03Rik; AI847694; AW049958; C-Jun-amino-terminal kinase-interacting protein 2; homologous to mouse JIP-1; IB 2; Ib2; IB-2; Islet brain 2; islet-brain 2; islet-brain-2; JIP 2; JIP2; JIP-2; JNK MAP kinase scaffold protein 2; JNK MAP kinase scaffold protein JIP2; JNK-interacting protein 2; Mapk8ip2; mitogen activated protein kinase 8 interacting protein 2; mitogen-activated protein kinase 8 interacting protein 2; mitogen-activated protein kinase 8-interacting protein 2; PRKM8IPL; R75148; si:dkey-180h12.2; si:dkey-181m21.1
Common Name JIP2
Gene Symbol MAPK8IP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.