Invitrogen™ Human JIP1 (aa 537-587) Control Fragment Recombinant Protein

Product Code. 30204847

Brand: Invitrogen™ RP105117

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcription factors, and decrease IL-1 beta and MAP kinase kinase 1 (MEKK1) induced apoptosis in pancreatic beta cells. This protein also functions as a DNA-binding transactivator of the glucose transporter GLUT2. RE1-silencing transcription factor (REST) is reported to repress the expression of this gene in insulin-secreting beta cells. This gene is found to be mutated in a type 2 diabetes family, and thus is thought to be a susceptibility gene for type 2 diabetes.

Specifications

• Accession Number: Q9UQF2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9479
• Name: Human JIP1 (aa 537-587) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C-Jun-amino-terminal kinase-interacting protein 1; Ib1; IB-1; Islet-brain 1; islet-brain-1; JIP1; JIP-1; JIP-1-related protein; JNK MAP kinase scaffold protein 1; JNK-interacting protein 1; JRP; Mapk8ip; Mapk8ip1; mitogen activated protein kinase 8 interacting protein; mitogen activated protein kinase 8 interacting protein 1; mitogen-activated protein kinase 8 interacting protein 1; mitogen-activated protein kinase 8-interacting protein 1; mjip-2 A; PRKM8 interacting protein; PRKM8IP; protein kinase, mitogen-activated 8 interacting protein; Skip
• Common Name: JIP1
• Gene Symbol: MAPK8IP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining