missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human JIP1 (aa 537-587) Control Fragment Recombinant Protein

Product Code. 30204847
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204847

Brand: Invitrogen™ RP105117

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcription factors, and decrease IL-1 beta and MAP kinase kinase 1 (MEKK1) induced apoptosis in pancreatic beta cells. This protein also functions as a DNA-binding transactivator of the glucose transporter GLUT2. RE1-silencing transcription factor (REST) is reported to repress the expression of this gene in insulin-secreting beta cells. This gene is found to be mutated in a type 2 diabetes family, and thus is thought to be a susceptibility gene for type 2 diabetes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UQF2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9479
Name Human JIP1 (aa 537-587) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C-Jun-amino-terminal kinase-interacting protein 1; Ib1; IB-1; Islet-brain 1; islet-brain-1; JIP1; JIP-1; JIP-1-related protein; JNK MAP kinase scaffold protein 1; JNK-interacting protein 1; JRP; Mapk8ip; Mapk8ip1; mitogen activated protein kinase 8 interacting protein; mitogen activated protein kinase 8 interacting protein 1; mitogen-activated protein kinase 8 interacting protein 1; mitogen-activated protein kinase 8-interacting protein 1; mjip-2 A; PRKM8 interacting protein; PRKM8IP; protein kinase, mitogen-activated 8 interacting protein; Skip
Common Name JIP1
Gene Symbol MAPK8IP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.