missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210777

Invitrogen™ Human JARID1C (aa 248-333) Control Fragment Recombinant Protein

Product Code. 30210777
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30210777

missing translation for 'mfr': Invitrogen™ RP106111

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83807 (PA5-83807. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1.; Isoform 4 can activate the JNK pathway. Involved in the regulation of actin cytoskeleton reorganization, cell-matrix adhesion, cell-cell adhesion and cell migration.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41229
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8242
Name Human JARID1C (aa 248-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D930009K15Rik; DXS1272E; Histone demethylase JARID1C; JARID1C; JmjC domain-containing protein SMCX; jumonji, AT rich interactive domain 1 C (Rbp2 like); Jumonji, AT rich interactive domain 1 C (RBP2-like); Jumonji/ARID domain-containing protein 1 C; KDM5C; Kiaa0234; lysine (K)-specific demethylase 5 C; lysine demethylase 5 C; lysine-specific demethylase 5 C; mKIAA0234; MR x 13; MRXJ; MRXSCJ; MRXSJ; Protein SmcX; Protein Xe169; RGD1560601; sele; selected mouse cDNA on the X; SMCX; Smcx homolog, x chromosome; Smcy homolog, X-linked; XE169
Common Name JARID1C
Gene Symbol KDM5C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.