Invitrogen™ Human JAM-A (CD321) (aa 31-101) Control Fragment Recombinant Protein

Product Code. 30199768

Brand: Invitrogen™ RP103420

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD321 (F11R, JAM-1, JAM-A) is a cell-surface adhesion molecule belonging to the Ig superfamily of receptors. CD321 is a 32-41 kD glycoprotein, possessing two extracellular Ig-like domains, a transmembrane region, and a short cytosolic tail. The protein assembles at the membrane as a homodimer, and can associate laterally with other membrane proteins including integrins. CD321 is expressed on a variety of cell types, including leukocytes, platelets, erythrocytes, stem cells, epithelial and endothelial cells, and plays a role in mediating cell-cell contact. CD321 can be found in close proximity to several components of epithelial tight junctions, including ZO-1 and occludin. CD321 is involved in the maintenance of epithelial and endothelial barriers, hematopoiesis, angiogenesis, and tumor proliferation, invasion, and metastasis.

Specifications

• Accession Number: Q9Y624
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50848
• Name: Human JAM-A (CD321) (aa 31-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9130004G24; AA638916; BV11 antigen; CD321; ESTM33; F11 R; F11 receptor; F11 receptor/F11R; F11R; JAM; JAM1; JAM-1; JAMA; JAM-A; Jcam; Jcam1; junction cell adhesion molecule A; junction cell adhesion molecule1; junctional adhesion molecule 1; Junctional adhesion molecule A; KAT; Ly106; PAM-1; Platelet adhesion molecule 1; platelet F11 receptor; UNQ264/PRO301
• Common Name: JAM-A (CD321)
• Gene Symbol: F11r
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining