Invitrogen™ Human JAKMIP2 (aa 317-387) Control Fragment Recombinant Protein

Product Code. 30207949

Brand: Invitrogen™ RP107396

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66740 (PA5-66740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JAKMIP2 (janus kinase and microtubule-interacting protein 2), also known as NECC1 (neuroendocrine long coiled-coil protein 1), CTCL tumor antigen HD-CL-04, JAMIP2 or KIAA0555, is a 810 amino acid protein belonging to the JAKMIP family. Localizing to the Golgi apparatus, JAKMIP2 is high expressed in brain, with moderate levels of expression found in thymus, spleen and lung. Existing as three alternatively spliced isoforms, the gene encoding JAKMIP2 maps to human chromosome 5q32 and mouse chromosome 18 B3. Chromosome 5 contains 181 million base pairs and comprises nearly 6% of the human genome. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome.

Specifications

• Accession Number: Q96AA8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9832
• Name: Human JAKMIP2 (aa 317-387) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430702L21Rik; AI850334; CTCL tumor antigen HD-CL-04; D930046L20Rik; Jak and microtubule interacting protein 2; JAKMIP2; JAMIP2; janus kinase and microtubule interacting protein 2; janus kinase and microtubule-interacting protein 2; KIAA0555; NECC1; Neuroendocrine long coiled-coil protein 1; RGD1559742
• Common Name: JAKMIP2
• Gene Symbol: Jakmip2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining