missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human JAK2 (aa 420-508) Control Fragment Recombinant Protein

Product Code. 30198549
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198549

Brand: Invitrogen™ RP104780

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Janus kinase 2 (JAK2) is a protein tyrosine kinase involved in a specific subset of cytokine receptor signaling pathways and is mutated in polycythemia vera. This kinase contains the catalytic domain (JH1) of JAK2. The activation of JAKs can lead to the phosphorylation of STAT (signal transducers and activatiors of transcription) proteins, which dimerize and translocate to the nucleus. Once translocated to the nucleus, the STAT proteins can modify transcription of numerous genes, including interferon-stimulated genes. JAK2 is required for the IFN gamma-receptor complex initiation and JAK1 functions as an amplifier. Some studies have suggested that the role of JAK2 might be performed by Tyk2 and JAK3, if they were positioned correctly within the IFN gamma-receptor complex. Mutations affecting JAK2 can cause Budd-Chiari syndrome, Polycythemia vera, Thrombocythemia 3, myelofibrosis, or Acute myelogenous leukemia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60674
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3717
Name Human JAK2 (aa 420-508) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EC 2.7.10.2; Fd17; JAK 2; JAK2; JAK-2; Janus kinase 2; Janus kinase 2 (a protein tyrosine kinase); JTK 10; JTK10; kinase Jak2; THCYT3; Tyrosine-protein kinase JAK2
Common Name JAK2
Gene Symbol JAK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.