Invitrogen™ Human IYD (aa 23-84) Control Fragment Recombinant Protein

Product Code. 30209087

Brand: Invitrogen™ RP101082

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63757 (PA5-63757. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q6PHW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389434
• Name: Human IYD (aa 23-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6orf71; DEHAL1; dJ422F24.1; iodotyrosine dehalogenase 1; iodotyrosine dehalogenase 1; iodotyrosine deiodinase 1; iodotyrosine deiodinase; iodotyrosine deiodinase 1; IYD; IYD-1; RGD1309288; TDH4
• Common Name: IYD
• Gene Symbol: IYD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining