Invitrogen™ Human IVNS1ABP (aa 343-472) Control Fragment Recombinant Protein

Product Code. 30209500

Brand: Invitrogen™ RP102250

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51926 (PA5-51926. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IVNS1ABP is a protein coding gene involved in many cell functions, including pre-mRNA splicing, the aryl hydrocarbon receptor (AHR) pathway, F-actin organization and protein ubiquitination. Plays a role in the dynamic organization of the actin skeleton as a stabilizer of actin filaments by association with F-actin through Kelch repeats. Protects cells from cell death induced by actin destabilization. Functions as modifier of the AHR/Aryl hydrocarbon receptor pathway increasing the concentration of AHR available to activate transcription. In addition, functions as a negative regulator of BCR(KLHL20) E3 ubiquitin ligase complex to prevent ubiquitin-mediated proteolysis of PML and DAPK1, two tumor suppressors. Inhibits pre-mRNA splicing (in vitro).; (Microbial infection) involved in the alternative splicing of influenza A virus M1 mRNA through interaction with HNRNPK, thereby facilitating the generation of viral M2 protein.

Specifications

• Accession Number: Q9Y6Y0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10625
• Name: Human IVNS1ABP (aa 343-472) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190004M08Rik; 1700126I16Rik; AA960440; ARA3; aryl hydrocarbon receptor-associated 3; aryl hydrocarbon receptor-associated protein 3; FLARA3; HSPC068; influenza virus NS1A binding protein; influenza virus NS1A-binding protein; Influenza virus NS1A-binding protein homolog; Ivns1abp; kelch family protein Nd1; kelch family protein Nd1-L; kelch-like family member 39; Kelch-like protein 39; KIAA0850; KLHL39; mKIAA0850; NCX downstream gene 1; ND1; Nd1L; Nd1-L; ND1-L2; Nd1S; Nd1-S; NS1; NS-1; NS1-binding protein; NS1-binding protein homolog; Ns1bp; NS1-BP
• Common Name: IVNS1ABP
• Gene Symbol: IVNS1ABP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining