Invitrogen™ Human IVD (aa 35-146) Control Fragment Recombinant Protein

Product Code. 30180519

Brand: Invitrogen™ RP98064

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59547 (PA5-59547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Isovaleryl-CoA dehydrogenase (IVD) is a mitochondrial matrix enzyme that catalyzes the third step in leucine catabolism. The genetic deficiency of IVD results in an accumulation of isovaleric acid, which is toxic to the central nervous system and leads to isovaleric acidemia.

Specifications

• Accession Number: P26440
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3712
• Name: Human IVD (aa 35-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300016K07Rik; 6720455E18Rik; ACAD2; AI463340; butyryl-CoA dehydrogenase; EGK_17362; isovaleryl CoA dehydrogenase; isovaleryl coenzyme A dehydrogenase; isovaleryl dehydrogenase; isovaleryl-CoA dehydrogenase; isovaleryl-CoA dehydrogenase, mitochondrial; IVD
• Common Name: IVD
• Gene Symbol: IVD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLPVDDAINGLSEEQRQLRQTMAKFLQEHLAPKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLCINQLVRNGNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining