Invitrogen™ Human ITSN1 (aa 940-1039) Control Fragment Recombinant Protein

Product Code. 30196226

Brand: Invitrogen™ RP91801

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53702 (PA5-53702. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a cytoplasmic membrane-associated protein that indirectly coordinates endocytic membrane traffic with the actin assembly machinery. In addition, the encoded protein may regulate the formation of clathrin-coated vesicles and could be involved in synaptic vesicle recycling. This protein has been shown to interact with dynamin, CDC42, SNAP23, SNAP25, SPIN90, EPS15, EPN1, EPN2, and STN2. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them have been characterized so far.

Specifications

• Accession Number: Q15811
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6453
• Name: Human ITSN1 (aa 940-1039) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA517634; AA545208; AI316805; AI839402; AI848451; EH and SH3 domains protein 1; EH domain and SH3 domain regulator of endocytosis 1; Eh domain, SH3 domain regulator of endocytosis 1; Ehsh1; Ese1; human intersectin-SH3 domain-containing protein SH3P17; intersectin (SH3 domain protein 1 A); intersectin 1; intersectin 1 (SH3 domain protein 1 A); intersectin 1 (SH3 domain protein); intersectin 1 short form variant 3; intersectin 1 short form variant, 11; intersectin 1; intersectin-1; intersectin short form 2 variant 2; intersectin short variant 12; intersectin-1; intersectin-L; Itsn; ITSN1; MGC134948; MGC134949; SH3 domain-containing protein 1 A; SH3D1A; SH3P17; Src homology 3 domain-containing protein
• Common Name: ITSN1
• Gene Symbol: ITSN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining