missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ITPA (aa 15-103) Control Fragment Recombinant Protein

Product Code. 30195230
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195230 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195230 Supplier Invitrogen™ Supplier No. RP109379

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BY32
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3704
Name Human ITPA (aa 15-103) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010016I08Rik; AU020102; C20orf37; dJ794I6.3; HAMAP-Rule:MF_03148}; HLC14-06-P; inosine triphosphatase; inosine triphosphatase (nucleoside triphosphate pyrophosphatase); inosine triphosphatase {ECO:0000255; inosine triphosphate pyrophosphatase; inosine triphosphate pyrophosphatase {ECO:0000255; inosine triphosphate pyrophosphohydrolase; Itp; ITPA; ITPase; ITPase {ECO:0000255; My049; My049 protein; Non-canonical purine NTP pyrophosphatase; non-canonical purine NTP pyrophosphatase {ECO:0000255; non-standard purine NTP pyrophosphatase; non-standard purine NTP pyrophosphatase {ECO:0000255; NTPase; NTPase {ECO:0000255; nucleoside triphosphate pyrophosphatase; nucleoside-triphosphate diphosphatase; nucleoside-triphosphate diphosphatase {ECO:0000255; Nucleoside-triphosphate pyrophosphatase; nucleoside-triphosphate pyrophosphatase {ECO:0000255; OK/SW-cl0.9; Putative oncogene protein hlc14-06-p
Common Name ITPA
Gene Symbol ITPA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.