Invitrogen™ Human ITIH4 (aa 765-904) Control Fragment Recombinant Protein

Product Code. 30202333

Brand: Invitrogen™ RP100488

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51641 (PA5-51641. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The inter-alpha-trypsin inhibitor (ITI, I-alpha-I) family is a classic example of protein-glycosaminoglycoprotein (PGP) complexes. They occur constitutively in plasma at relatively high concentrations and results from alternating combinations of three kinds of heavy chains with a common light chain called the bikunin proteoglycan. Bikunin has two proteinase inhibotor domains and belongs to the Kunitz-type protease inhibitor family; it displays an inhibitory activity against trypsin, leukocyte elastase and plasmin. The heavy chains do not have any protease inhibitory properties but have the capacity to interact in vitro and in vivo with hyaluronic acid and this binding promotes the stability of the extra-cellular matrix. The ITI protein family is suspected of playing a key role in the extra-cellular matrix biology.

Specifications

• Accession Number: Q14624
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3700
• Name: Human ITIH4 (aa 765-904) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 35 kDa inter-alpha-trypsin inhibitor heavy chain H4; 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; DKFZp686G21125; Gp120; H4P; IHRP; Inter alpha-trypsin inhibitor, heavy chain 4; inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein); inter-alpha-inhibitor heavy chain 4; inter-alpha-trypsin inhibitor family heavy chain-related protein; inter-alpha-trypsin inhibitor heavy chain 4; inter-alpha-trypsin inhibitor heavy chain family member 4; inter-alpha-trypsin inhibitor heavy chain family, member 4; inter-alpha-trypsin inhibitor heavy chain H4; inter-alpha-trypsin inhibitor, heavy chain-like, 1; ITI heavy chain H4; Itih4; Itih-4; ITI-HC4; ITIHL1; PK120; Pk.-120; Plasma kallikrein sensitive glycoprotein 120; plasma kallikrein-sensitive glycoprotein 120; PRO1851
• Common Name: ITIH4
• Gene Symbol: ITIH4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining