Invitrogen™ Human ITIH2 (aa 172-267) Control Fragment Recombinant Protein

Product Code. 30197152

Brand: Invitrogen™ RP101364

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain (see MIM 176870) and a variable number of heavy chains (Salier et al., 1987 [PubMed 2446322]; Himmelfarb et al., 2004 [PubMed 14744536]). ITI-HC2 may act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.

Specifications

• Accession Number: P19823
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3698
• Name: Human ITIH2 (aa 172-267) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI747202; H2P; HC2; IGHEP2; inter-alpha (globulin) inhibitor H2; inter-alpha (globulin) inhibitor, H2 polypeptide; inter-alpha trypsin inhibitor, heavy chain 2; inter-alpha-inhibitor heavy chain 2; inter-alpha-trypsin inhibitor complex component II; inter-alpha-trypsin inhibitor heavy chain 2; inter-alpha-trypsin inhibitor heavy chain H2; Intin2; ITI heavy chain H2; ITIH2; Itih-2; ITI-HC2; PSMA1; Serum-derived hyaluronan-associated protein; SHAP
• Common Name: ITIH2
• Gene Symbol: ITIH2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining