Invitrogen™ Human ITGB3BP (aa 92-175) Control Fragment Recombinant Protein

Product Code. 30199835

Brand: Invitrogen™ RP94264

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55865 (PA5-55865. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. It induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP may also act as an inhibitor of cyclin A-associated kinase. ITGB3BP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Specifications

• Accession Number: Q13352
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23421
• Name: Human ITGB3BP (aa 92-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930471O16Rik; AU022583; beta 3 endonexin; beta-3-endonexin; beta3-endonexin; Cenpr; CENP-R; Centromere protein R; HSU37139; integrin beta 3 binding protein (beta3-endonexin); integrin beta-3-binding protein; integrin subunit beta 3 binding protein; Itgb3bp; Nrif3; Nuclear receptor-interacting factor 3; TAP20
• Common Name: ITGB3BP
• Gene Symbol: ITGB3BP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining