Invitrogen™ Human ITCH (aa 197-273) Control Fragment Recombinant Protein

Product Code. 30204159

Brand: Invitrogen™ RP104867

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65539 (PA5-65539. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells.

Specifications

• Accession Number: Q96J02
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83737
• Name: Human ITCH (aa 197-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6720481N21Rik; 8030492O04Rik; A130065M08; ADMFD; AIF4; AIP4; atrophin-1 interacting protein 4; Atrophin-1-interacting protein 4; C230047C07Rik; dJ468O1.1; E3 ubiquitin-protein ligase Itchy; E3 ubiquitin-protein ligase Itchy homolog; HECT-type E3 ubiquitin transferase Itchy homolog; ITCH; itch E3 ubiquitin ligase; itchy E3 ubiquitin protein ligase; itchy E3 ubiquitin protein ligase homolog; itchy, E3 ubiquitin protein ligase; NAPP1; NFE2-associated polypeptide 1
• Common Name: ITCH
• Gene Symbol: ITCH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining