missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IST1 (aa 2-79) Control Fragment Recombinant Protein

Product Code. 30181411
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181411

Brand: Invitrogen™ RP98776

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62981 (PA5-62981. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proposed to be involved in specific functions of the ESCRT machinery. Is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvement in the MVB pathway is not established. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P53990
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9798
Name Human IST1 (aa 2-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2400003C14Rik; AW536298; fb16b04; hIST1; hypothetical protein LOC321460; hypothetical protein LOC508900; increased sodium tolerance 1 homolog; increased sodium tolerance 1 homolog (yeast); IST1; IST1 factor associated with ESCRT-III; IST1 homolog; IST1, endosomal sorting complex required for transport-III component; IST1, ESCRT-III associated factor; IST1-like protein; Kiaa0174; KIAA0174-like protein; MAPK activating protein PM28; MGC117220; mKIAA0174; OLC1; overexpressed in lung cancer 1; pm28; putative MAPK-activating protein PM28; RGD1307799; wu:fb16b04; wu:fi89e07; zgc:55671
Common Name IST1
Gene Symbol IST1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.