Invitrogen™ Human ISOC1 (aa 231-298) Control Fragment Recombinant Protein

Product Code. 30194302

Brand: Invitrogen™ RP107740

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67096 (PA5-67096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ISOC1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include catalytic activity.

Specifications

• Accession Number: Q96CN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51015
• Name: Human ISOC1 (aa 231-298) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610034N03Rik; CGI-111; Down-regulated in nephrectomized rat kidney #1; down-regulated in nephrectomized rat kidney protein 1; DR-NR#1; DR-NR1; isoc1; isochorismatase domain containing 1; isochorismatase domain-containing protein 1; isochorismatase domain-containing protein 1; LOW QUALITY PROTEIN: isochorismatase domain-containing protein 1; RGD1307632; zgc:153699
• Common Name: ISOC1
• Gene Symbol: ISOC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining