Invitrogen™ Human ISM2 (aa 209-286) Control Fragment Recombinant Protein

Product Code. 30182105

Brand: Invitrogen™ RP98360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58910 (PA5-58910. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a type 1 thrombospondin domain, which is present in thrombospondin, a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Specifications

• Accession Number: Q6H9L7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 145501
• Name: Human ISM2 (aa 209-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm264; ISM2; isthmin 2; isthmin 2 homolog; isthmin 2 homolog (zebrafish); isthmin-2; PSEC0137; TAIL1; thrombospondin and AMOP containing isthmin-like 1; thrombospondin and AMOP domain-containing isthmin-like protein 1; Thrombospondin type-1 domain-containing protein 3; thrombospondin, type I domain-containing 3; thrombospondin, type I, domain containing 3; THSD3
• Common Name: ISM2
• Gene Symbol: ISM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining