Invitrogen™ Human ISL2 (aa 1-35) Control Fragment Recombinant Protein

Product Code. 30196488

Brand: Invitrogen™ RP108038

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67377 (PA5-67377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ISL2 is a transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.

Specifications

• Accession Number: Q96A47
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64843
• Name: Human ISL2 (aa 1-35) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110001N10Rik; Insulin gene enhancer protein ISL-2; insulin related protein 2 (islet 2); ISL LIM homeobox 2; ISL2; Isl-2; ISL2 transcription factor, LIM/homeodomain, (islet-2); islet 2; islet-2
• Common Name: ISL2
• Gene Symbol: ISL2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining