Invitrogen™ Human IRGC (aa 292-373) Control Fragment Recombinant Protein

Product Code. 30181268

Brand: Invitrogen™ RP99017

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63810 (PA5-63810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Immunity-related GTPases (IRG) (also known as p47 GTPases) are a family of GTPase proteins found in vertebrates, which play critical roles in mediating innate resistance to intracellular pathogens. IRG genes have been found in a number of mammals and lower species including mice, rats, zebrafish and humans. Most of the mouse genes contain interferon-stimulated response elements which mediate transcriptional activation by IFNs. In humans, only two IRG genes have been found: human IRGC encodes a full-length IRG protein that, like the mouse homologue, is constitutively expressed in testis, while human IRGM encodes a considerably truncated protein that is constitutively expressed in cultured cells including some macrophage cell lines. As the two human genes IRGC and IRGM are not subject to IFN control, it has been suggested that the host resistance mechanism supported by IRG proteins in the mouse is lacking in humans.

Specifications

• Accession Number: Q6NXR0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56269
• Name: Human IRGC (aa 292-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CINEMA; cinema 1; F630044M05Rik; Gm1102; Gm474; IFGGE; Iigp5; immunity related GTPase cinema; immunity-related GTPase cinema 1; immunity-related GTPase family, cinema; immunity-related GTPase family, cinema 1; interferon inducible GTPase 5; interferon inducible GTPase family member 5; interferon-gamma-inducible GTPase IFGGE protein; interferon-inducible GTPase 5; Irgc; IRGC1; R30953_1; RGD1311107
• Common Name: IRGC
• Gene Symbol: Irgc
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining