Invitrogen™ Human IRF2 (aa 87-188) Control Fragment Recombinant Protein

Product Code. 30208625

Brand: Invitrogen™ RP102258

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83159 (PA5-83159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IRF2 belongs to the interferon regulatory factor family. IRF2 regulates the transcription regulation important to cell proliferation as well as immune responses by binding to the upstream regulatory region of type I IFN and IFNinducible MHC class I genes (the interferon consensus sequence (ICS)) and repression of those genes. However, IRF2 also functions as a transcriptional activator of histone H4 by interactions with NF-kappa B.

Specifications

• Accession Number: P14316
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3660
• Name: Human IRF2 (aa 87-188) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9830146E22Rik; AI646973; DKFZp686F0244; Interferon regulatory factor 2; IRF2; Irf-2; OTTHUMP00000218576; OTTHUMP00000218580
• Common Name: IRF2
• Gene Symbol: IRF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining