missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213463

Invitrogen™ Human IREB2 (aa 124-216) Control Fragment Recombinant Protein

Product Code. 30213463
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213463

Brand: Invitrogen™ RP105984

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Iron regulatory protein 2 (IRP2) is a central post-transcriptional regulator of cellular and systemic iron metabolism. It is a cytosolic RNA-binding protein that binds to stem-loop structures. IRP2 is regulated by iron-mediated proteolysis. Hypoxia is important for normal tissue physiology as well as being a component of several pathophysiological conditions, including heart and cerebrovascular diseases and tumor growth. Because iron and oxygen are closely related, IRP2 also plays a role during hypoxia (low oxygen).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48200
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3658
Name Human IREB2 (aa 124-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACO3; D9Ertd85e; FLJ23381; im:7153062; Ireb2; IRE-BP 2; IREBP2; Iron regulatory protein 2; iron responsive element binding protein 2; iron-regulatory protein 2; iron-responsive element binding protein 2; iron-responsive element-binding protein 2; Iron-responsive element-binding protein 2-like protein; IRP2; IRP2AD
Common Name IREB2
Gene Symbol IREB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.