Invitrogen™ Human IQCD (aa 15-90) Control Fragment Recombinant Protein

Product Code. 30202091

Brand: Invitrogen™ RP100817

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61336 (PA5-61336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q96DY2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115811
• Name: Human IQCD (aa 15-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933433C09Rik; AI662646; CFAP84; Drc10; Dynein regulatory complex protein 10; dynein regulatory complex subunit 10; IQ domain-containing protein D; IQ motif containing D; Iqcd
• Common Name: IQCD
• Gene Symbol: IQCD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKRIMSILDEAIYKVELVTLLSYVASNREDMEGMLGEDVMRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining