Invitrogen™ Human IPMK (aa 290-373) Control Fragment Recombinant Protein

Product Code. 30201641

Brand: Invitrogen™ RP106783

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111456 (PA5-111456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1, 3, 4, 5, 6-pentakisphosphate, and has a preferred 5-kinase activity. This gene may play a role in nuclear mRNA export. Pseudogenes of this gene are located on the long arm of chromosome 13 and the short arm of chromosome 19.

Specifikationer

• Accession Number: Q8NFU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 253430
• Name: Human IPMK (aa 290-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410017C19Rik; AA408208; Impk; Inositol 1,3,4,6-tetrakisphosphate 5-kinase; inositol polyphosphate kinase 2; inositol polyphosphate multikinase; Ipk2; Ipmk; LOW QUALITY PROTEIN: inositol polyphosphate multikinase
• Common Name: IPMK
• Gene Symbol: IPMK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPTGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining