Invitrogen™ Human IP3 Receptor 2 (aa 2418-2479) Control Fragment Recombinant Protein

Product Code. 30193671

Brand: Invitrogen™ RP103717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inositol 1,4,5-trisphosphate (IP3) is a second messenger for many growth factors, hormones, and neuro-transmitters. Upon binding to IP3R, IP3 triggers the release of intracellular, luminal calcium to the cytosol. Functional IP3R is a homo- or heterotetramer of ∽240 kDa glycoprotein subunits. IP3R protein is structurally and functionally related to one other important intracellular calcium-release channel, the ryanodine receptor. The similarity between the two receptors continues at the physiological level owing to a physical association each receptor can have with the immunophilin protein, FKBP12. Phosphorylation of the IP3R by PKC causes an increase in IP3-mediated calcium release. Concomitantly, the phosphatase activity of calcineurin is stimulated upon its association with the FKBP12-IP3R complex. Calcium release is reduced when the PKC target site on the IP3R is dephosphorylated by calcineurin resulting in calcium oscillations. Mammalian IP3R subunits are the product of three distinct genes that are widely expressed and differentially regulated. IP3R type I (IP3R-I) has been detected in heart, liver, kidney, ovary, and Purkinje neurons of the cerebellum. IP3R-II is found predominantly in the brain. IP3R-III is known to be expressed in pancreatic islets, kidney, and the gastrointestinal tract.

Specifications

• Accession Number: Q14571
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3709
• Name: Human IP3 Receptor 2 (aa 2418-2479) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI649341; ANHD; CFAP48; cilia and flagella associated protein 48; inositol 1,4,5-triphosphate receptor 2; inositol 1,4,5-triphosphate receptor 5; inositol 1,4,5-triphosphate receptor, type 2; inositol 1,4,5-trisphosphate receptor type 2; inositol 1,4,5-trisphosphate receptor, type 2; inositol 1,4,5-trisphosphate type V receptor; inositol triphosphate receptor type 2; inositol trisphosphate receptor type 2; insP3R2; InsP3R-2; InsP3R-5; IP3 receptor; IP3 receptor isoform 2; IP3 receptor/Ca2+ channel type 2; IP3R; IP3R 2; IP3R2; Itpr2; Itpr5; LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 2; si:dkey-196d8.1; Type 2 inositol 1,4,5-trisphosphate receptor; type 2 InsP3 receptor
• Common Name: IP3 Receptor 2
• Gene Symbol: ITPR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining