Invitrogen™ Human INPP5B (aa 33-99) Control Fragment Recombinant Protein

Product Code. 30198588

Brand: Invitrogen™ RP94576

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83033 (PA5-83033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Specifications

• Accession Number: P32019
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3633
• Name: Human INPP5B (aa 33-99) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5 PTase; 75 kDa inositol polyphosphate-5-phosphatase; AW260155; inositol polyphosphate-5-phosphatase B; inositol polyphosphate-5-phosphatase, 75 kDa; INPP5B; INPP5P; LOW QUALITY PROTEIN: type II inositol 1,4,5-trisphosphate 5-phosphatase; MGC65156; MGC71303; OCRL2; Phosphoinositide 5-phosphatase; RP11-109P14.7; type II inositol 1,4,5-trisphosphate 5-phosphatase; type II inositol 1,4,5-trisphosphate 5-phosphatase; LOW QUALITY PROTEIN: type II inositol 1,4,5-trisphosphate 5-phosphatase; type II inositol-1
• Common Name: INPP5B
• Gene Symbol: INPP5B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining