Invitrogen™ Human INO80C (aa 36-104) Control Fragment Recombinant Protein

Product Code. 30182802

missing translation for 'mfr': Invitrogen™ RP98245

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61869 (PA5-61869. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

INO80C is a proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.

Specifications

• Accession Number: Q6PI98
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 125476
• Name: Human INO80C (aa 36-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C18orf37; hIes6; IES6; IES6 homolog; INO80 complex subunit C; INO80C
• Common Name: INO80C
• Gene Symbol: INO80C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining