Invitrogen™ Human INO80B (aa 143-219) Control Fragment Recombinant Protein

Product Code. 30196040

Brand: Invitrogen™ RP108569

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84845 (PA5-84845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IN80B induces growth and cell cycle arrests at the G1 phase of the cell cycle.

Specifications

• Accession Number: Q9C086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83444
• Name: Human INO80B (aa 143-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510009I23Rik; hIes2; High mobility group AT-hook 1-like 4; HMG1YL4; Hmga1l4; HMGIYL4; IES2; IES2 homolog; INO80 complex subunit B; Ino80b; PAP (Pim-1 associated protein) associated protein 1; PAP-1 binding protein; PAP-1-associated protein 1; PAP-1 BP; Papa1; PAPA-1; RGD1562258; zgc:153347; Zinc finger HIT domain-containing protein 4; zinc finger, HIT type 4; ZNHIT4
• Common Name: INO80B
• Gene Symbol: INO80B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining