Invitrogen™ Human INMT (aa 137-187) Control Fragment Recombinant Protein

Product Code. 30206341

Brand: Invitrogen™ RP107054

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66379 (PA5-66379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.

Specifications

• Accession Number: O95050
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11185
• Name: Human INMT (aa 137-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Amine N-methyltransferase; aromatic alkylamine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; Indolethylamine N-methyltransferase; Inmt; nicotine N-methyltransferase; Temt; Thioether S-methyltransferase
• Common Name: INMT
• Gene Symbol: INMT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining