Invitrogen™ Human ING3 (aa 96-176) Control Fragment Recombinant Protein

Product Code. 30209577

Brand: Invitrogen™ RP103655

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111622 (PA5-111622. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed.

Specifications

• Accession Number: Q9NXR8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54556
• Name: Human ING3 (aa 96-176) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300013A07Rik; Eaf 4; Eaf4; FLJ20089; HSPC301; ING 2; ING 3; ING2; ING3; ing3 protein; inhibitor of growth family member 3; inhibitor of growth family, member 3; inhibitor of growth protein 3; inhibitor of growth protein 3-like protein; MEAF4; p47 p47 ING3; p47 regulator protein; p47ING3; p47ING3 protein; zgc:56327
• Common Name: ING3
• Gene Symbol: ING3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining